PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_013635070.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family LBD
Protein Properties Length: 192aa    MW: 21387.3 Da    PI: 6.3319
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_013635070.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260139.79.8e-4491081100
          DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaela 95 
                     +Ca+Ck+lrr+CakdC++apyfp ++p+kfa+vhk+FGasnv+k+l++lp ++r da++slv+eA+ar+rdPvyG+vg i+ lq+q++ql+ +la
  XP_013635070.1   9 PCASCKLLRRRCAKDCIFAPYFPPDDPHKFAIVHKVFGASNVSKMLQELPVNQRADAVNSLVFEANARVRDPVYGCVGAISYLQNQVSQLQMQLA 103
                     7********************************************************************************************** PP

          DUF260  96 llkee 100
                     ++++e
  XP_013635070.1 104 VAQAE 108
                     99987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089126.7858109IPR004883Lateral organ boundaries, LOB
PfamPF031951.6E-439106IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 192 aa     Download sequence    Send to blast
MGGPGSSSPC ASCKLLRRRC AKDCIFAPYF PPDDPHKFAI VHKVFGASNV SKMLQELPVN  60
QRADAVNSLV FEANARVRDP VYGCVGAISY LQNQVSQLQM QLAVAQAEIL CIQMQHEQPL  120
QSHHQVLELD QDEKALLLNN NNINNCNNDN NNLGYAMSSG QFNSNFASPS SIMQMQMQMQ  180
MQDPLKQESL WT
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB1643060.0AB164306.1 Arabidopsis thaliana ASL5 mRNA for ASYMMETRIC LEAVES2-like gene 5 protein, partial cds.
GenBankAB4738380.0AB473838.1 Arabidopsis thaliana ASL5 mRNA for ASYMMETRIC LEAVES2-like 5 protein, complete cds.
GenBankAY0869600.0AY086960.1 Arabidopsis thaliana clone 29970 mRNA, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013635070.11e-141PREDICTED: LOB domain-containing protein 12
RefseqXP_013731173.11e-141PREDICTED: LOB domain-containing protein 12
SwissprotQ8LBW31e-111LBD12_ARATH; LOB domain-containing protein 12
TrEMBLA0A0D3C3011e-141A0A0D3C301_BRAOL; Uncharacterized protein
STRINGBra021612.1-P1e-114(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM13128340
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G30130.11e-104LBD family protein